Free Game UI Assets
← Browse all panels in the library
Home / Assets / Panels / panel_rect_white-silver_chamfer_03

panel_rect_white-silver_chamfer_03

Free panel game UI asset · metallic · SVG · CC0 1.0

panel_rect_white-silver_chamfer_03 — game UI panel
whitesilverpanelcleanminimalchamferscifirich
Open in app

SVG & PNG · recolor · trim — in the editor

This asset is released under CC0 1.0 Universal (public domain). You can use, modify and redistribute it for free, including in commercial games, with no attribution required. See the license page for details.

Related panels